Anti TRAT1 pAb (ATL-HPA072760 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA072760-25

Protein Description: T cell receptor associated transmembrane adaptor 1
Gene Name: TRAT1
Alternative Gene Name: HSPC062, TCRIM, TRIM
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030775: 66%, ENSRNOG00000029564: 64%
Entrez Gene ID: 50852
Uniprot ID: Q6PIZ9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: IDASVSKTTLVDSFSPESQAVEENIHDDPIRLFGLIRAKREPIN
• Gene Sequence: IDASVSKTTLVDSFSPESQAVEENIHDDPIRLFGLIRAKREPIN
• Gene ID - Mouse: ENSMUSG00000030775
• Gene ID - Rat: ENSRNOG00000029564
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.