Anti TRAPPC4 pAb (ATL-HPA041371)

Atlas Antibodies

Catalog No.: ATL-HPA041371-25

Protein Description: trafficking protein particle complex 4
Gene Name: TRAPPC4
Alternative Gene Name: PTD009, SBDN, TRS23
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032112: 99%, ENSRNOG00000011904: 99%
Entrez Gene ID: 51399
Uniprot ID: Q9Y296
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: HCYQTLTGIKFVVLADPRQAGIDSLLRKIYEIYSDFALKNPFYSLEMPIRCELFDQNLKLALEVAEKAGT
• Gene Sequence: HCYQTLTGIKFVVLADPRQAGIDSLLRKIYEIYSDFALKNPFYSLEMPIRCELFDQNLKLALEVAEKAGT
• Gene ID - Mouse: ENSMUSG00000032112
• Gene ID - Rat: ENSRNOG00000011904
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.