Anti TRAPPC2L pAb (ATL-HPA041714)

Atlas Antibodies

Catalog No.: ATL-HPA041714-100

Protein Description: trafficking protein particle complex 2-like
Gene Name: TRAPPC2L
Alternative Gene Name: HSPC176
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000015013: 99%, ENSRNOG00000014581: 100%
Entrez Gene ID: 51693
Uniprot ID: Q9UL33
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MAVCIAVIAKENYPLYIRSTPTENELKFHYMVHTSLDVVDEKISAMGKALVDQRELYLGLLYPTEDYKVYG
• Gene Sequence: MAVCIAVIAKENYPLYIRSTPTENELKFHYMVHTSLDVVDEKISAMGKALVDQRELYLGLLYPTEDYKVYG
• Gene ID - Mouse: ENSMUSG00000015013
• Gene ID - Rat: ENSRNOG00000014581
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti TRAPPC2L pAb (ATL-HPA041714) – 1 Found

Vit, Gianmatteo; Duro, Joana; Rajendraprasad, Girish; Hertz, Emil P T; Holland, Lya Katrine Kauffeldt; Weisser, Melanie Bianca; McEwan, Brennan C; Lopez-Mendez, Blanca; Sotelo-Parrilla, Paula; Jeyaprakash, A Arockia; Montoya, Guillermo; Mailand, Niels; Maeda, Kenji; Kettenbach, Arminja; Barisic, Marin; Nilsson, Jakob. Chemogenetic profiling reveals PP2A-independent cytotoxicity of proposed PP2A activators iHAP1 and DT-061. The Embo Journal. 2022;41(14):e110611.