Anti TRAPPC2 pAb (ATL-HPA063308)

Atlas Antibodies

Catalog No.: ATL-HPA063308-25

Protein Description: trafficking protein particle complex 2
Gene Name: TRAPPC2
Alternative Gene Name: hYP38334, MIP-2A, SEDL, SEDT, TRS20, ZNF547L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000079317: 99%, ENSRNOG00000042276: 99%
Entrez Gene ID: 6399
Uniprot ID: P0DI81
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SFYFVIVGHHDNPVFEMEFLPAGKAESKDDHRHLNQFIAHAALDLVDENMWLSNNMYLKTVDKFNEWFVSAF
• Gene Sequence: SFYFVIVGHHDNPVFEMEFLPAGKAESKDDHRHLNQFIAHAALDLVDENMWLSNNMYLKTVDKFNEWFVSAF
• Gene ID - Mouse: ENSMUSG00000079317
• Gene ID - Rat: ENSRNOG00000042276
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.