Anti TRAPPC2 pAb (ATL-HPA063308)

Atlas Antibodies

Catalog No.:
ATL-HPA063308-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: trafficking protein particle complex 2
Gene Name: TRAPPC2
Alternative Gene Name: hYP38334, MIP-2A, SEDL, SEDT, TRS20, ZNF547L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000079317: 99%, ENSRNOG00000042276: 99%
Entrez Gene ID: 6399
Uniprot ID: P0DI81
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SFYFVIVGHHDNPVFEMEFLPAGKAESKDDHRHLNQFIAHAALDLVDENMWLSNNMYLKTVDKFNEWFVSAF
Gene Sequence SFYFVIVGHHDNPVFEMEFLPAGKAESKDDHRHLNQFIAHAALDLVDENMWLSNNMYLKTVDKFNEWFVSAF
Gene ID - Mouse ENSMUSG00000079317
Gene ID - Rat ENSRNOG00000042276
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TRAPPC2 pAb (ATL-HPA063308)
Datasheet Anti TRAPPC2 pAb (ATL-HPA063308) Datasheet (External Link)
Vendor Page Anti TRAPPC2 pAb (ATL-HPA063308) at Atlas Antibodies

Documents & Links for Anti TRAPPC2 pAb (ATL-HPA063308)
Datasheet Anti TRAPPC2 pAb (ATL-HPA063308) Datasheet (External Link)
Vendor Page Anti TRAPPC2 pAb (ATL-HPA063308)