Anti TRAM2 pAb (ATL-HPA057925)

Atlas Antibodies

Catalog No.:
ATL-HPA057925-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: translocation associated membrane protein 2
Gene Name: TRAM2
Alternative Gene Name: KIAA0057
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041779: 100%, ENSRNOG00000013046: 90%
Entrez Gene ID: 9697
Uniprot ID: Q15035
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AFLFILPQYNISVPTADSETVHYHYGPKDL
Gene Sequence AFLFILPQYNISVPTADSETVHYHYGPKDL
Gene ID - Mouse ENSMUSG00000041779
Gene ID - Rat ENSRNOG00000013046
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TRAM2 pAb (ATL-HPA057925)
Datasheet Anti TRAM2 pAb (ATL-HPA057925) Datasheet (External Link)
Vendor Page Anti TRAM2 pAb (ATL-HPA057925) at Atlas Antibodies

Documents & Links for Anti TRAM2 pAb (ATL-HPA057925)
Datasheet Anti TRAM2 pAb (ATL-HPA057925) Datasheet (External Link)
Vendor Page Anti TRAM2 pAb (ATL-HPA057925)