Anti TRAIP pAb (ATL-HPA036262 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA036262-25

Protein Description: TRAF interacting protein
Gene Name: TRAIP
Alternative Gene Name: RNF206, TRIP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032586: 60%, ENSRNOG00000030101: 65%
Entrez Gene ID: 10293
Uniprot ID: Q9BWF2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LNLPPVASETVDRLVLESPAPVEVNLKLRRPSFRDDIDLNATFDVDTPPARPSSSQHGYYEKLCLEKSHSPIQDVPKKICKGPRKESQLSL
• Gene Sequence: LNLPPVASETVDRLVLESPAPVEVNLKLRRPSFRDDIDLNATFDVDTPPARPSSSQHGYYEKLCLEKSHSPIQDVPKKICKGPRKESQLSL
• Gene ID - Mouse: ENSMUSG00000032586
• Gene ID - Rat: ENSRNOG00000030101
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti TRAIP pAb (ATL-HPA036262 w/enhanced validation) – 1 Found

Huang, Siyuan; Wei, Yong-Kai; Kaliamurthi, Satyavani; Cao, Yanghui; Nangraj, Asma Sindhoo; Sui, Xin; Chu, Dan; Wang, Huan; Wei, Dong-Qing; Peslherbe, Gilles H; Selvaraj, Gurudeeban; Shi, Jiang. Circulating miR-1246 Targeting UBE2C, TNNI3, TRAIP, UCHL1 Genes and Key Pathways as a Potential Biomarker for Lung Adenocarcinoma: Integrated Biological Network Analysis. Journal Of Personalized Medicine. 2020;10(4)