Anti TRAF6 pAb (ATL-HPA020599)

Atlas Antibodies

Catalog No.: ATL-HPA020599-25

Protein Description: TNF receptor-associated factor 6, E3 ubiquitin protein ligase
Gene Name: TRAF6
Alternative Gene Name: RNF85
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027164: 85%, ENSRNOG00000004639: 84%
Entrez Gene ID: 7189
Uniprot ID: Q9Y4K3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ISEVRNFQETIHQLEGRLVRQDHQIRELTAKMETQSMYVSELKRTIRTLEDKVAEIEAQQCNGIYIWKIGNFGMHLKCQEEEKPV
• Gene Sequence: ISEVRNFQETIHQLEGRLVRQDHQIRELTAKMETQSMYVSELKRTIRTLEDKVAEIEAQQCNGIYIWKIGNFGMHLKCQEEEKPV
• Gene ID - Mouse: ENSMUSG00000027164
• Gene ID - Rat: ENSRNOG00000004639
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti TRAF6 pAb (ATL-HPA020599) – 2 Found

Donnelly, Christopher R; Gabreski, Nicole A; Suh, Esther B; Chowdhury, Monzurul; Pierchala, Brian A. Non-canonical Ret signaling augments p75-mediated cell death in developing sympathetic neurons. The Journal Of Cell Biology. 2018;217(9):3237-3253. 

Chen, Fa-Xiu; Shen, Yi; Liu, Yang; Wang, Hai-Feng; Liang, Chen-Yu; Luo, Ming. Inflammation-dependent downregulation of miR-532-3p mediates apoptotic signaling in human sarcopenia through targeting BAK1. International Journal Of Biological Sciences. 16(9):1481-1494.