Anti TRAF6 pAb (ATL-HPA020599)

Atlas Antibodies

Catalog No.:
ATL-HPA020599-25
Shipping:
Calculated at Checkout
$351.00
Adding to cart… The item has been added
Protein Description: TNF receptor-associated factor 6, E3 ubiquitin protein ligase
Gene Name: TRAF6
Alternative Gene Name: RNF85
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027164: 85%, ENSRNOG00000004639: 84%
Entrez Gene ID: 7189
Uniprot ID: Q9Y4K3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ISEVRNFQETIHQLEGRLVRQDHQIRELTAKMETQSMYVSELKRTIRTLEDKVAEIEAQQCNGIYIWKIGNFGMHLKCQEEEKPV
Gene Sequence ISEVRNFQETIHQLEGRLVRQDHQIRELTAKMETQSMYVSELKRTIRTLEDKVAEIEAQQCNGIYIWKIGNFGMHLKCQEEEKPV
Gene ID - Mouse ENSMUSG00000027164
Gene ID - Rat ENSRNOG00000004639
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TRAF6 pAb (ATL-HPA020599)
Datasheet Anti TRAF6 pAb (ATL-HPA020599) Datasheet (External Link)
Vendor Page Anti TRAF6 pAb (ATL-HPA020599) at Atlas Antibodies

Documents & Links for Anti TRAF6 pAb (ATL-HPA020599)
Datasheet Anti TRAF6 pAb (ATL-HPA020599) Datasheet (External Link)
Vendor Page Anti TRAF6 pAb (ATL-HPA020599)
Citations for Anti TRAF6 pAb (ATL-HPA020599) – 2 Found
Donnelly, Christopher R; Gabreski, Nicole A; Suh, Esther B; Chowdhury, Monzurul; Pierchala, Brian A. Non-canonical Ret signaling augments p75-mediated cell death in developing sympathetic neurons. The Journal Of Cell Biology. 2018;217(9):3237-3253.  PubMed
Chen, Fa-Xiu; Shen, Yi; Liu, Yang; Wang, Hai-Feng; Liang, Chen-Yu; Luo, Ming. Inflammation-dependent downregulation of miR-532-3p mediates apoptotic signaling in human sarcopenia through targeting BAK1. International Journal Of Biological Sciences. 16(9):1481-1494.  PubMed