Anti TRADD pAb (ATL-HPA071341)

Atlas Antibodies

Catalog No.:
ATL-HPA071341-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: TNFRSF1A associated via death domain
Gene Name: TRADD
Alternative Gene Name: Hs.89862
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031887: 71%, ENSRNOG00000015179: 76%
Entrez Gene ID: 8717
Uniprot ID: Q15628
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NGHEEWVGSAYLFVESSLDKVVLSDAYAHPQQKVAVYRVLQ
Gene Sequence NGHEEWVGSAYLFVESSLDKVVLSDAYAHPQQKVAVYRVLQ
Gene ID - Mouse ENSMUSG00000031887
Gene ID - Rat ENSRNOG00000015179
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TRADD pAb (ATL-HPA071341)
Datasheet Anti TRADD pAb (ATL-HPA071341) Datasheet (External Link)
Vendor Page Anti TRADD pAb (ATL-HPA071341) at Atlas Antibodies

Documents & Links for Anti TRADD pAb (ATL-HPA071341)
Datasheet Anti TRADD pAb (ATL-HPA071341) Datasheet (External Link)
Vendor Page Anti TRADD pAb (ATL-HPA071341)