Anti TRA2A pAb (ATL-HPA054018)

Atlas Antibodies

Catalog No.:
ATL-HPA054018-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: transformer 2 alpha homolog (Drosophila)
Gene Name: TRA2A
Alternative Gene Name: AWMS1, htra-2-alpha, tra2a
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029817: 100%, ENSRNOG00000009156: 100%
Entrez Gene ID: 29896
Uniprot ID: Q13595
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SDVEENNFEGRESRSQSKSPTGTPARVKSESRSGSR
Gene Sequence SDVEENNFEGRESRSQSKSPTGTPARVKSESRSGSR
Gene ID - Mouse ENSMUSG00000029817
Gene ID - Rat ENSRNOG00000009156
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TRA2A pAb (ATL-HPA054018)
Datasheet Anti TRA2A pAb (ATL-HPA054018) Datasheet (External Link)
Vendor Page Anti TRA2A pAb (ATL-HPA054018) at Atlas Antibodies

Documents & Links for Anti TRA2A pAb (ATL-HPA054018)
Datasheet Anti TRA2A pAb (ATL-HPA054018) Datasheet (External Link)
Vendor Page Anti TRA2A pAb (ATL-HPA054018)