Anti TRA2A pAb (ATL-HPA054018)

Atlas Antibodies

SKU: ATL-HPA054018-25

• 
• 

Protein Description: transformer 2 alpha homolog (Drosophila)
Gene Name: TRA2A
Alternative Gene Name: AWMS1, htra-2-alpha, tra2a
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029817: 100%, ENSRNOG00000009156: 100%
Entrez Gene ID: 29896
Uniprot ID: Q13595
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SDVEENNFEGRESRSQSKSPTGTPARVKSESRSGSR
• Gene Sequence: SDVEENNFEGRESRSQSKSPTGTPARVKSESRSGSR
• Gene ID - Mouse: ENSMUSG00000029817
• Gene ID - Rat: ENSRNOG00000009156
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.