Anti TRA2A pAb (ATL-HPA054018)
Atlas Antibodies
- Catalog No.:
- ATL-HPA054018-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: TRA2A
Alternative Gene Name: AWMS1, htra-2-alpha, tra2a
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029817: 100%, ENSRNOG00000009156: 100%
Entrez Gene ID: 29896
Uniprot ID: Q13595
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | SDVEENNFEGRESRSQSKSPTGTPARVKSESRSGSR |
Gene Sequence | SDVEENNFEGRESRSQSKSPTGTPARVKSESRSGSR |
Gene ID - Mouse | ENSMUSG00000029817 |
Gene ID - Rat | ENSRNOG00000009156 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti TRA2A pAb (ATL-HPA054018) | |
Datasheet | Anti TRA2A pAb (ATL-HPA054018) Datasheet (External Link) |
Vendor Page | Anti TRA2A pAb (ATL-HPA054018) at Atlas Antibodies |
Documents & Links for Anti TRA2A pAb (ATL-HPA054018) | |
Datasheet | Anti TRA2A pAb (ATL-HPA054018) Datasheet (External Link) |
Vendor Page | Anti TRA2A pAb (ATL-HPA054018) |