Anti TPST1 pAb (ATL-HPA061837)
Atlas Antibodies
- SKU:
- ATL-HPA061837-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: TPST1
Alternative Gene Name: TANGO13A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034118: 97%, ENSRNOG00000000900: 95%
Entrez Gene ID: 8460
Uniprot ID: O60507
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | PNYGKPDPKIIENTRRVYKGEFQLPDFLKEKPQTEQVE |
Gene Sequence | PNYGKPDPKIIENTRRVYKGEFQLPDFLKEKPQTEQVE |
Gene ID - Mouse | ENSMUSG00000034118 |
Gene ID - Rat | ENSRNOG00000000900 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti TPST1 pAb (ATL-HPA061837) | |
Datasheet | Anti TPST1 pAb (ATL-HPA061837) Datasheet (External Link) |
Vendor Page | Anti TPST1 pAb (ATL-HPA061837) at Atlas Antibodies |
Documents & Links for Anti TPST1 pAb (ATL-HPA061837) | |
Datasheet | Anti TPST1 pAb (ATL-HPA061837) Datasheet (External Link) |
Vendor Page | Anti TPST1 pAb (ATL-HPA061837) |