Anti TPSG1 pAb (ATL-HPA060458 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA060458-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: tryptase gamma 1
Gene Name: TPSG1
Alternative Gene Name: PRSS31, TMT
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033200: 65%, ENSRNOG00000018701: 59%
Entrez Gene ID: 25823
Uniprot ID: Q9NRR2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PYSLREVKVSVVDTETCRRDYPGPGGSILQPDMLCAR
Gene Sequence PYSLREVKVSVVDTETCRRDYPGPGGSILQPDMLCAR
Gene ID - Mouse ENSMUSG00000033200
Gene ID - Rat ENSRNOG00000018701
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TPSG1 pAb (ATL-HPA060458 w/enhanced validation)
Datasheet Anti TPSG1 pAb (ATL-HPA060458 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti TPSG1 pAb (ATL-HPA060458 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti TPSG1 pAb (ATL-HPA060458 w/enhanced validation)
Datasheet Anti TPSG1 pAb (ATL-HPA060458 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti TPSG1 pAb (ATL-HPA060458 w/enhanced validation)