Anti TPSB2 pAb (ATL-HPA049153)
Atlas Antibodies
- Catalog No.:
- ATL-HPA049153-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: TPSB2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024173: 70%, ENSRNOG00000018611: 73%
Entrez Gene ID: 64499
Uniprot ID: P20231
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | VKVPIMENHICDAKYHLGAYTGDDVRIVRD |
| Gene Sequence | VKVPIMENHICDAKYHLGAYTGDDVRIVRD |
| Gene ID - Mouse | ENSMUSG00000024173 |
| Gene ID - Rat | ENSRNOG00000018611 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti TPSB2 pAb (ATL-HPA049153) | |
| Datasheet | Anti TPSB2 pAb (ATL-HPA049153) Datasheet (External Link) |
| Vendor Page | Anti TPSB2 pAb (ATL-HPA049153) at Atlas Antibodies |
| Documents & Links for Anti TPSB2 pAb (ATL-HPA049153) | |
| Datasheet | Anti TPSB2 pAb (ATL-HPA049153) Datasheet (External Link) |
| Vendor Page | Anti TPSB2 pAb (ATL-HPA049153) |