Anti TPSB2 pAb (ATL-HPA049153)

Atlas Antibodies

Catalog No.:
ATL-HPA049153-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: tryptase beta 2 (gene/pseudogene)
Gene Name: TPSB2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024173: 70%, ENSRNOG00000018611: 73%
Entrez Gene ID: 64499
Uniprot ID: P20231
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VKVPIMENHICDAKYHLGAYTGDDVRIVRD
Gene Sequence VKVPIMENHICDAKYHLGAYTGDDVRIVRD
Gene ID - Mouse ENSMUSG00000024173
Gene ID - Rat ENSRNOG00000018611
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TPSB2 pAb (ATL-HPA049153)
Datasheet Anti TPSB2 pAb (ATL-HPA049153) Datasheet (External Link)
Vendor Page Anti TPSB2 pAb (ATL-HPA049153) at Atlas Antibodies

Documents & Links for Anti TPSB2 pAb (ATL-HPA049153)
Datasheet Anti TPSB2 pAb (ATL-HPA049153) Datasheet (External Link)
Vendor Page Anti TPSB2 pAb (ATL-HPA049153)