Anti TPRN pAb (ATL-HPA076667)

Atlas Antibodies

Catalog No.:
ATL-HPA076667-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: taperin
Gene Name: TPRN
Alternative Gene Name: C9orf75, DFNB79, FLJ90254
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048707: 71%, ENSRNOG00000010896: 67%
Entrez Gene ID: 286262
Uniprot ID: Q4KMQ1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ATSTNDSFEIRPAPKPVMETIPLGDLQARALASLRANSRNSFMVIPKSKASGAPPPEGRQSVELPKGDLG
Gene Sequence ATSTNDSFEIRPAPKPVMETIPLGDLQARALASLRANSRNSFMVIPKSKASGAPPPEGRQSVELPKGDLG
Gene ID - Mouse ENSMUSG00000048707
Gene ID - Rat ENSRNOG00000010896
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TPRN pAb (ATL-HPA076667)
Datasheet Anti TPRN pAb (ATL-HPA076667) Datasheet (External Link)
Vendor Page Anti TPRN pAb (ATL-HPA076667) at Atlas Antibodies

Documents & Links for Anti TPRN pAb (ATL-HPA076667)
Datasheet Anti TPRN pAb (ATL-HPA076667) Datasheet (External Link)
Vendor Page Anti TPRN pAb (ATL-HPA076667)