Anti TPRN pAb (ATL-HPA020899 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA020899-25

Protein Description: taperin
Gene Name: TPRN
Alternative Gene Name: C9orf75, DFNB79, FLJ90254
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048707: 75%, ENSRNOG00000010896: 72%
Entrez Gene ID: 286262
Uniprot ID: Q4KMQ1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ADRAIRWQRPSSPPPFLPAASEEAEPAEGLRVPGLAKNSREYVRPGLPVTFIDEVDSEEAPQAAKLPYLP
• Gene Sequence: ADRAIRWQRPSSPPPFLPAASEEAEPAEGLRVPGLAKNSREYVRPGLPVTFIDEVDSEEAPQAAKLPYLP
• Gene ID - Mouse: ENSMUSG00000048707
• Gene ID - Rat: ENSRNOG00000010896
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti TPRN pAb (ATL-HPA020899 w/enhanced validation) – 5 Found

Liu, Chang; Luo, Na; Tung, Chun-Yu; Perrin, Benjamin J; Zhao, Bo. GRXCR2 Regulates Taperin Localization Critical for Stereocilia Morphology and Hearing. Cell Reports. 2018;25(5):1268-1280.e4. 

Rehman, Atteeq Ur; Morell, Robert J; Belyantseva, Inna A; Khan, Shahid Y; Boger, Erich T; Shahzad, Mohsin; Ahmed, Zubair M; Riazuddin, Saima; Khan, Shaheen N; Riazuddin, Sheikh; Friedman, Thomas B. Targeted capture and next-generation sequencing identifies C9orf75, encoding taperin, as the mutated gene in nonsyndromic deafness DFNB79. American Journal Of Human Genetics. 2010;86(3):378-88. 

Salles, Felipe T; Andrade, Leonardo R; Tanda, Soichi; Grati, M'hamed; Plona, Kathleen L; Gagnon, Leona H; Johnson, Kenneth R; Kachar, Bechara; Berryman, Mark A. CLIC5 stabilizes membrane-actin filament linkages at the base of hair cell stereocilia in a molecular complex with radixin, taperin, and myosin VI. Cytoskeleton (Hoboken, N.j.). 2014;71(1):61-78. 

Li, Jinan; Liu, Chang; Zhao, Bo. N-Terminus of GRXCR2 Interacts With CLIC5 and Is Essential for Auditory Perception. Frontiers In Cell And Developmental Biology. 9( 34026762):671364. 

Liu, Chang; Zhao, Bo. Murine GRXCR1 Has a Different Function Than GRXCR2 in the Morphogenesis of Stereocilia. Frontiers In Cellular Neuroscience. 15( 34366792):714070.