Anti TPRG1L pAb (ATL-HPA063163)
Atlas Antibodies
- Catalog No.:
- ATL-HPA063163-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: TPRG1L
Alternative Gene Name: FAM79A, FLJ21811, RP11-46F15.3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029030: 94%, ENSRNOG00000046227: 94%
Entrez Gene ID: 127262
Uniprot ID: Q5T0D9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | PLRQTLWPLSIHDPTRRARVKEYFVFRPGSIEQAVEEIRVVVRPVEDGEIQGVWLLTEVDHWNNEK |
Gene Sequence | PLRQTLWPLSIHDPTRRARVKEYFVFRPGSIEQAVEEIRVVVRPVEDGEIQGVWLLTEVDHWNNEK |
Gene ID - Mouse | ENSMUSG00000029030 |
Gene ID - Rat | ENSRNOG00000046227 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti TPRG1L pAb (ATL-HPA063163) | |
Datasheet | Anti TPRG1L pAb (ATL-HPA063163) Datasheet (External Link) |
Vendor Page | Anti TPRG1L pAb (ATL-HPA063163) at Atlas Antibodies |
Documents & Links for Anti TPRG1L pAb (ATL-HPA063163) | |
Datasheet | Anti TPRG1L pAb (ATL-HPA063163) Datasheet (External Link) |
Vendor Page | Anti TPRG1L pAb (ATL-HPA063163) |