Anti TPRG1L pAb (ATL-HPA063163)

Atlas Antibodies

Catalog No.:
ATL-HPA063163-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: tumor protein p63 regulated 1-like
Gene Name: TPRG1L
Alternative Gene Name: FAM79A, FLJ21811, RP11-46F15.3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029030: 94%, ENSRNOG00000046227: 94%
Entrez Gene ID: 127262
Uniprot ID: Q5T0D9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PLRQTLWPLSIHDPTRRARVKEYFVFRPGSIEQAVEEIRVVVRPVEDGEIQGVWLLTEVDHWNNEK
Gene Sequence PLRQTLWPLSIHDPTRRARVKEYFVFRPGSIEQAVEEIRVVVRPVEDGEIQGVWLLTEVDHWNNEK
Gene ID - Mouse ENSMUSG00000029030
Gene ID - Rat ENSRNOG00000046227
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TPRG1L pAb (ATL-HPA063163)
Datasheet Anti TPRG1L pAb (ATL-HPA063163) Datasheet (External Link)
Vendor Page Anti TPRG1L pAb (ATL-HPA063163) at Atlas Antibodies

Documents & Links for Anti TPRG1L pAb (ATL-HPA063163)
Datasheet Anti TPRG1L pAb (ATL-HPA063163) Datasheet (External Link)
Vendor Page Anti TPRG1L pAb (ATL-HPA063163)