Anti TPRG1L pAb (ATL-HPA063163)

Atlas Antibodies

Catalog No.: ATL-HPA063163-25

Protein Description: tumor protein p63 regulated 1-like
Gene Name: TPRG1L
Alternative Gene Name: FAM79A, FLJ21811, RP11-46F15.3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029030: 94%, ENSRNOG00000046227: 94%
Entrez Gene ID: 127262
Uniprot ID: Q5T0D9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PLRQTLWPLSIHDPTRRARVKEYFVFRPGSIEQAVEEIRVVVRPVEDGEIQGVWLLTEVDHWNNEK
• Gene Sequence: PLRQTLWPLSIHDPTRRARVKEYFVFRPGSIEQAVEEIRVVVRPVEDGEIQGVWLLTEVDHWNNEK
• Gene ID - Mouse: ENSMUSG00000029030
• Gene ID - Rat: ENSRNOG00000046227
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.