Anti TPRG1 pAb (ATL-HPA060187)
Atlas Antibodies
- Catalog No.:
- ATL-HPA060187-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: TPRG1
Alternative Gene Name: FAM79B, FLJ41238, FLJ43694
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048399: 85%, ENSRNOG00000001923: 85%
Entrez Gene ID: 285386
Uniprot ID: Q6ZUI0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | TFTEHPMKYTSEKFLEICKLSGFMSKLVPAIQNAHKNSTGSGRGKKLMVLTEPILIETYTG |
Gene Sequence | TFTEHPMKYTSEKFLEICKLSGFMSKLVPAIQNAHKNSTGSGRGKKLMVLTEPILIETYTG |
Gene ID - Mouse | ENSMUSG00000048399 |
Gene ID - Rat | ENSRNOG00000001923 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti TPRG1 pAb (ATL-HPA060187) | |
Datasheet | Anti TPRG1 pAb (ATL-HPA060187) Datasheet (External Link) |
Vendor Page | Anti TPRG1 pAb (ATL-HPA060187) at Atlas Antibodies |
Documents & Links for Anti TPRG1 pAb (ATL-HPA060187) | |
Datasheet | Anti TPRG1 pAb (ATL-HPA060187) Datasheet (External Link) |
Vendor Page | Anti TPRG1 pAb (ATL-HPA060187) |