Anti TPRG1 pAb (ATL-HPA060187)

Atlas Antibodies

Catalog No.: ATL-HPA060187-25

Protein Description: tumor protein p63 regulated 1
Gene Name: TPRG1
Alternative Gene Name: FAM79B, FLJ41238, FLJ43694
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048399: 85%, ENSRNOG00000001923: 85%
Entrez Gene ID: 285386
Uniprot ID: Q6ZUI0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TFTEHPMKYTSEKFLEICKLSGFMSKLVPAIQNAHKNSTGSGRGKKLMVLTEPILIETYTG
• Gene Sequence: TFTEHPMKYTSEKFLEICKLSGFMSKLVPAIQNAHKNSTGSGRGKKLMVLTEPILIETYTG
• Gene ID - Mouse: ENSMUSG00000048399
• Gene ID - Rat: ENSRNOG00000001923
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.