Anti TPPP3 pAb (ATL-HPA061691 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA061691-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: tubulin polymerization promoting protein family member 3
Gene Name: TPPP3
Alternative Gene Name: CGI-38, p20, p25gamma
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000014846: 97%, ENSRNOG00000016890: 97%
Entrez Gene ID: 51673
Uniprot ID: Q9BW30
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen STDMAGLEESFRKFAIHGDPKASGQEMNGKNWA
Gene Sequence STDMAGLEESFRKFAIHGDPKASGQEMNGKNWA
Gene ID - Mouse ENSMUSG00000014846
Gene ID - Rat ENSRNOG00000016890
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TPPP3 pAb (ATL-HPA061691 w/enhanced validation)
Datasheet Anti TPPP3 pAb (ATL-HPA061691 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti TPPP3 pAb (ATL-HPA061691 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti TPPP3 pAb (ATL-HPA061691 w/enhanced validation)
Datasheet Anti TPPP3 pAb (ATL-HPA061691 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti TPPP3 pAb (ATL-HPA061691 w/enhanced validation)