Anti TPPP3 pAb (ATL-HPA061691 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA061691-25

Protein Description: tubulin polymerization promoting protein family member 3
Gene Name: TPPP3
Alternative Gene Name: CGI-38, p20, p25gamma
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000014846: 97%, ENSRNOG00000016890: 97%
Entrez Gene ID: 51673
Uniprot ID: Q9BW30
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: STDMAGLEESFRKFAIHGDPKASGQEMNGKNWA
• Gene Sequence: STDMAGLEESFRKFAIHGDPKASGQEMNGKNWA
• Gene ID - Mouse: ENSMUSG00000014846
• Gene ID - Rat: ENSRNOG00000016890
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.