Anti TPMT pAb (ATL-HPA062364)

Atlas Antibodies

Catalog No.:
ATL-HPA062364-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: thiopurine S-methyltransferase
Gene Name: TPMT
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021376: 83%, ENSRNOG00000016468: 86%
Entrez Gene ID: 7172
Uniprot ID: P51580
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GHSVVGVEISELGIQEFFTEQNLSYSEEPITEIPGTKVFKSSSGNISLYCCSIFDLPRTNIGKFDMIWDRG
Gene Sequence GHSVVGVEISELGIQEFFTEQNLSYSEEPITEIPGTKVFKSSSGNISLYCCSIFDLPRTNIGKFDMIWDRG
Gene ID - Mouse ENSMUSG00000021376
Gene ID - Rat ENSRNOG00000016468
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TPMT pAb (ATL-HPA062364)
Datasheet Anti TPMT pAb (ATL-HPA062364) Datasheet (External Link)
Vendor Page Anti TPMT pAb (ATL-HPA062364) at Atlas Antibodies

Documents & Links for Anti TPMT pAb (ATL-HPA062364)
Datasheet Anti TPMT pAb (ATL-HPA062364) Datasheet (External Link)
Vendor Page Anti TPMT pAb (ATL-HPA062364)