Anti TPM3 pAb (ATL-HPA009066)

Atlas Antibodies

Catalog No.: ATL-HPA009066-25

Protein Description: tropomyosin 3
Gene Name: TPM3
Alternative Gene Name: NEM1, TRK
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027940: 100%, ENSRNOG00000017441: 100%
Entrez Gene ID: 7170
Uniprot ID: P06753
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AERLQREVEGERRAREQAEAEVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIENRALKDEEKMELQEIQLKEAKHIAEEADRKYEEVARKLVIIEGDLERTEERAELAESRCREMDEQIRLMDQNLKCLSA
• Gene Sequence: AERLQREVEGERRAREQAEAEVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIENRALKDEEKMELQEIQLKEAKHIAEEADRKYEEVARKLVIIEGDLERTEERAELAESRCREMDEQIRLMDQNLKCLSA
• Gene ID - Mouse: ENSMUSG00000027940
• Gene ID - Rat: ENSRNOG00000017441
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti TPM3 pAb (ATL-HPA009066) – 2 Found

Singleton, D C; Rouhi, P; Zois, C E; Haider, S; Li, J-L; Kessler, B M; Cao, Y; Harris, A L. Hypoxic regulation of RIOK3 is a major mechanism for cancer cell invasion and metastasis. Oncogene. 2015;34(36):4713-22. 

Lau, Betty; Kerr, Karen; Camiolo, Salvatore; Nightingale, Katie; Gu, Quan; Antrobus, Robin; Suárez, Nicolás M; Loney, Colin; Stanton, Richard J; Weekes, Michael P; Davison, Andrew J. Human Cytomegalovirus RNA2.7 Is Required for Upregulating Multiple Cellular Genes To Promote Cell Motility and Viral Spread Late in Lytic Infection. Journal Of Virology. 2021;95(20):e0069821.