Anti TPGS2 pAb (ATL-HPA061753)

Atlas Antibodies

Catalog No.:
ATL-HPA061753-100
Shipping:
Calculated at Checkout
$638.00
Adding to cart… The item has been added
Protein Description: tubulin polyglutamylase complex subunit 2
Gene Name: TPGS2
Alternative Gene Name: C18orf10, DKFZP586M1523, HsT3006
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024269: 84%, ENSRNOG00000054118: 81%
Entrez Gene ID: 25941
Uniprot ID: Q68CL5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TQLTQSSMYSLPNAPTLADLEDDTHEASDDQPEKPHFDSRSVIFELDSCNGSGKVCLVYKSGKPALAEDTEIWFLDRALYWHFL
Gene Sequence TQLTQSSMYSLPNAPTLADLEDDTHEASDDQPEKPHFDSRSVIFELDSCNGSGKVCLVYKSGKPALAEDTEIWFLDRALYWHFL
Gene ID - Mouse ENSMUSG00000024269
Gene ID - Rat ENSRNOG00000054118
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TPGS2 pAb (ATL-HPA061753)
Datasheet Anti TPGS2 pAb (ATL-HPA061753) Datasheet (External Link)
Vendor Page Anti TPGS2 pAb (ATL-HPA061753) at Atlas Antibodies

Documents & Links for Anti TPGS2 pAb (ATL-HPA061753)
Datasheet Anti TPGS2 pAb (ATL-HPA061753) Datasheet (External Link)
Vendor Page Anti TPGS2 pAb (ATL-HPA061753)