Anti TPGS2 pAb (ATL-HPA061753)

Atlas Antibodies

Catalog No.: ATL-HPA061753-100

Protein Description: tubulin polyglutamylase complex subunit 2
Gene Name: TPGS2
Alternative Gene Name: C18orf10, DKFZP586M1523, HsT3006
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024269: 84%, ENSRNOG00000054118: 81%
Entrez Gene ID: 25941
Uniprot ID: Q68CL5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TQLTQSSMYSLPNAPTLADLEDDTHEASDDQPEKPHFDSRSVIFELDSCNGSGKVCLVYKSGKPALAEDTEIWFLDRALYWHFL
• Gene Sequence: TQLTQSSMYSLPNAPTLADLEDDTHEASDDQPEKPHFDSRSVIFELDSCNGSGKVCLVYKSGKPALAEDTEIWFLDRALYWHFL
• Gene ID - Mouse: ENSMUSG00000024269
• Gene ID - Rat: ENSRNOG00000054118
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.