Anti TPGS2 pAb (ATL-HPA061753)
Atlas Antibodies
- Catalog No.:
- ATL-HPA061753-100
- Shipping:
- Calculated at Checkout
$596.00
Gene Name: TPGS2
Alternative Gene Name: C18orf10, DKFZP586M1523, HsT3006
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024269: 84%, ENSRNOG00000054118: 81%
Entrez Gene ID: 25941
Uniprot ID: Q68CL5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | TQLTQSSMYSLPNAPTLADLEDDTHEASDDQPEKPHFDSRSVIFELDSCNGSGKVCLVYKSGKPALAEDTEIWFLDRALYWHFL |
Gene Sequence | TQLTQSSMYSLPNAPTLADLEDDTHEASDDQPEKPHFDSRSVIFELDSCNGSGKVCLVYKSGKPALAEDTEIWFLDRALYWHFL |
Gene ID - Mouse | ENSMUSG00000024269 |
Gene ID - Rat | ENSRNOG00000054118 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti TPGS2 pAb (ATL-HPA061753) | |
Datasheet | Anti TPGS2 pAb (ATL-HPA061753) Datasheet (External Link) |
Vendor Page | Anti TPGS2 pAb (ATL-HPA061753) at Atlas Antibodies |
Documents & Links for Anti TPGS2 pAb (ATL-HPA061753) | |
Datasheet | Anti TPGS2 pAb (ATL-HPA061753) Datasheet (External Link) |
Vendor Page | Anti TPGS2 pAb (ATL-HPA061753) |