Anti TPD52L1 pAb (ATL-HPA027916 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA027916-25

Protein Description: tumor protein D52-like 1
Gene Name: TPD52L1
Alternative Gene Name: D53, hD53
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000296: 94%, ENSRNOG00000021478: 90%
Entrez Gene ID: 7164
Uniprot ID: Q16890
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MEAQAQGLLETEPLQGTDEDAVASADFSSMLSEEEKEELKAELVQLEDEITTLRQVLSAKERHLVEI
• Gene Sequence: MEAQAQGLLETEPLQGTDEDAVASADFSSMLSEEEKEELKAELVQLEDEITTLRQVLSAKERHLVEI
• Gene ID - Mouse: ENSMUSG00000000296
• Gene ID - Rat: ENSRNOG00000021478
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti TPD52L1 pAb (ATL-HPA027916 w/enhanced validation) – 1 Found

Li, Jingwen; Li, Yongmin; Liu, He; Liu, Yanlong; Cui, Binbin. The four-transmembrane protein MAL2 and tumor protein D52 (TPD52) are highly expressed in colorectal cancer and correlated with poor prognosis. Plos One. 12(5):e0178515.