Anti TPD52 pAb (ATL-HPA062167 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA062167-100
- Shipping:
- Calculated at Checkout
$638.00
Gene Name: TPD52
Alternative Gene Name: D52, hD52, N8L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027506: 80%, ENSRNOG00000011441: 84%
Entrez Gene ID: 7163
Uniprot ID: P55327
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | KSFEEKVENLKSKVGGTKPAGGDFGEVLNSAANASATTTEPLPEKTQESL |
| Gene Sequence | KSFEEKVENLKSKVGGTKPAGGDFGEVLNSAANASATTTEPLPEKTQESL |
| Gene ID - Mouse | ENSMUSG00000027506 |
| Gene ID - Rat | ENSRNOG00000011441 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti TPD52 pAb (ATL-HPA062167 w/enhanced validation) | |
| Datasheet | Anti TPD52 pAb (ATL-HPA062167 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti TPD52 pAb (ATL-HPA062167 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti TPD52 pAb (ATL-HPA062167 w/enhanced validation) | |
| Datasheet | Anti TPD52 pAb (ATL-HPA062167 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti TPD52 pAb (ATL-HPA062167 w/enhanced validation) |