Anti TPD52 pAb (ATL-HPA062167 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA062167-100
Shipping:
Calculated at Checkout
$638.00
Adding to cart… The item has been added
Protein Description: tumor protein D52
Gene Name: TPD52
Alternative Gene Name: D52, hD52, N8L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027506: 80%, ENSRNOG00000011441: 84%
Entrez Gene ID: 7163
Uniprot ID: P55327
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KSFEEKVENLKSKVGGTKPAGGDFGEVLNSAANASATTTEPLPEKTQESL
Gene Sequence KSFEEKVENLKSKVGGTKPAGGDFGEVLNSAANASATTTEPLPEKTQESL
Gene ID - Mouse ENSMUSG00000027506
Gene ID - Rat ENSRNOG00000011441
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TPD52 pAb (ATL-HPA062167 w/enhanced validation)
Datasheet Anti TPD52 pAb (ATL-HPA062167 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti TPD52 pAb (ATL-HPA062167 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti TPD52 pAb (ATL-HPA062167 w/enhanced validation)
Datasheet Anti TPD52 pAb (ATL-HPA062167 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti TPD52 pAb (ATL-HPA062167 w/enhanced validation)