Anti TP53RK pAb (ATL-HPA015837)

Atlas Antibodies

Catalog No.: ATL-HPA015837-100

Protein Description: TP53 regulating kinase
Gene Name: TP53RK
Alternative Gene Name: BUD32, C20orf64, dJ101A2.2, Nori-2p, prpk
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042854: 87%, ENSRNOG00000007285: 87%
Entrez Gene ID: 112858
Uniprot ID: Q96S44
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AAVIKHRFPKGYRHPALEARLGRRRTVQEARALLRCRRAGISAPVVFFVDYASNCLYMEEIEGSVTVRDYIQSTMETEKTPQGLSNLAKTIGQV
• Gene Sequence: AAVIKHRFPKGYRHPALEARLGRRRTVQEARALLRCRRAGISAPVVFFVDYASNCLYMEEIEGSVTVRDYIQSTMETEKTPQGLSNLAKTIGQV
• Gene ID - Mouse: ENSMUSG00000042854
• Gene ID - Rat: ENSRNOG00000007285
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.