Anti TP53INP1 pAb (ATL-HPA005856)

Atlas Antibodies

Catalog No.: ATL-HPA005856-25

Protein Description: tumor protein p53 inducible nuclear protein 1
Gene Name: TP53INP1
Alternative Gene Name: DKFZp434M1317, FLJ22139, P53DINP1, SIP, Teap, TP53INP1A, TP53INP1B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028211: 84%, ENSRNOG00000007964: 82%
Entrez Gene ID: 94241
Uniprot ID: Q96A56
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VEAQNEMGQHIHCYVAALAAHTTFLEQPKSFRPSQWIKEHSERQPLNRNSLRRQNLTRDCHPRQVKHNGWVVHQPC
• Gene Sequence: VEAQNEMGQHIHCYVAALAAHTTFLEQPKSFRPSQWIKEHSERQPLNRNSLRRQNLTRDCHPRQVKHNGWVVHQPC
• Gene ID - Mouse: ENSMUSG00000028211
• Gene ID - Rat: ENSRNOG00000007964
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.