Anti TP53I11 pAb (ATL-HPA061276)
Atlas Antibodies
- Catalog No.:
- ATL-HPA061276-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: TP53I11
Alternative Gene Name: PIG11
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000068735: 96%, ENSRNOG00000008738: 96%
Entrez Gene ID: 9537
Uniprot ID: O14683
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | PLMKKHSQTDLVSRLKTRKILGVGGEDDDGEVHRSKISQVLGNEIKFTIREP |
Gene Sequence | PLMKKHSQTDLVSRLKTRKILGVGGEDDDGEVHRSKISQVLGNEIKFTIREP |
Gene ID - Mouse | ENSMUSG00000068735 |
Gene ID - Rat | ENSRNOG00000008738 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti TP53I11 pAb (ATL-HPA061276) | |
Datasheet | Anti TP53I11 pAb (ATL-HPA061276) Datasheet (External Link) |
Vendor Page | Anti TP53I11 pAb (ATL-HPA061276) at Atlas Antibodies |
Documents & Links for Anti TP53I11 pAb (ATL-HPA061276) | |
Datasheet | Anti TP53I11 pAb (ATL-HPA061276) Datasheet (External Link) |
Vendor Page | Anti TP53I11 pAb (ATL-HPA061276) |