Anti TP53BP1 pAb (ATL-HPA022133 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA022133-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: tumor protein p53 binding protein 1
Gene Name: TP53BP1
Alternative Gene Name: 53BP1, p202
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043909: 85%, ENSRNOG00000013837: 86%
Entrez Gene ID: 7158
Uniprot ID: Q12888
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC, ChIP
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen VPSPATRSEALSSVLDQEEAMEIKEHHPEEGSSGSEVEEIPETPCESQGEELKEENMESVPLHLSLTETQSQGLCLQKEMPKKECSEAMEVETSVISIDSPQKLA
Gene Sequence VPSPATRSEALSSVLDQEEAMEIKEHHPEEGSSGSEVEEIPETPCESQGEELKEENMESVPLHLSLTETQSQGLCLQKEMPKKECSEAMEVETSVISIDSPQKLA
Gene ID - Mouse ENSMUSG00000043909
Gene ID - Rat ENSRNOG00000013837
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TP53BP1 pAb (ATL-HPA022133 w/enhanced validation)
Datasheet Anti TP53BP1 pAb (ATL-HPA022133 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti TP53BP1 pAb (ATL-HPA022133 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti TP53BP1 pAb (ATL-HPA022133 w/enhanced validation)
Datasheet Anti TP53BP1 pAb (ATL-HPA022133 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti TP53BP1 pAb (ATL-HPA022133 w/enhanced validation)