Anti TP53BP1 pAb (ATL-HPA022133 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA022133-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: TP53BP1
Alternative Gene Name: 53BP1, p202
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043909: 85%, ENSRNOG00000013837: 86%
Entrez Gene ID: 7158
Uniprot ID: Q12888
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC, ChIP |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | VPSPATRSEALSSVLDQEEAMEIKEHHPEEGSSGSEVEEIPETPCESQGEELKEENMESVPLHLSLTETQSQGLCLQKEMPKKECSEAMEVETSVISIDSPQKLA |
| Gene Sequence | VPSPATRSEALSSVLDQEEAMEIKEHHPEEGSSGSEVEEIPETPCESQGEELKEENMESVPLHLSLTETQSQGLCLQKEMPKKECSEAMEVETSVISIDSPQKLA |
| Gene ID - Mouse | ENSMUSG00000043909 |
| Gene ID - Rat | ENSRNOG00000013837 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti TP53BP1 pAb (ATL-HPA022133 w/enhanced validation) | |
| Datasheet | Anti TP53BP1 pAb (ATL-HPA022133 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti TP53BP1 pAb (ATL-HPA022133 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti TP53BP1 pAb (ATL-HPA022133 w/enhanced validation) | |
| Datasheet | Anti TP53BP1 pAb (ATL-HPA022133 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti TP53BP1 pAb (ATL-HPA022133 w/enhanced validation) |