Anti TP53AIP1 pAb (ATL-HPA048797)

Atlas Antibodies

Catalog No.:
ATL-HPA048797-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: tumor protein p53 regulated apoptosis inducing protein 1
Gene Name: TP53AIP1
Alternative Gene Name: p53AIP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006403: 28%, ENSRNOG00000025069: 30%
Entrez Gene ID: 63970
Uniprot ID: Q9HCN2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GIEALSVSSGSWSSATVWILTGLGLGLSRPFLPGATVLRDRPLGSAFELSYDQKKAPLRLQ
Gene Sequence GIEALSVSSGSWSSATVWILTGLGLGLSRPFLPGATVLRDRPLGSAFELSYDQKKAPLRLQ
Gene ID - Mouse ENSMUSG00000006403
Gene ID - Rat ENSRNOG00000025069
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TP53AIP1 pAb (ATL-HPA048797)
Datasheet Anti TP53AIP1 pAb (ATL-HPA048797) Datasheet (External Link)
Vendor Page Anti TP53AIP1 pAb (ATL-HPA048797) at Atlas Antibodies

Documents & Links for Anti TP53AIP1 pAb (ATL-HPA048797)
Datasheet Anti TP53AIP1 pAb (ATL-HPA048797) Datasheet (External Link)
Vendor Page Anti TP53AIP1 pAb (ATL-HPA048797)