Anti TP53AIP1 pAb (ATL-HPA048797)
Atlas Antibodies
- Catalog No.:
- ATL-HPA048797-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: TP53AIP1
Alternative Gene Name: p53AIP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006403: 28%, ENSRNOG00000025069: 30%
Entrez Gene ID: 63970
Uniprot ID: Q9HCN2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | GIEALSVSSGSWSSATVWILTGLGLGLSRPFLPGATVLRDRPLGSAFELSYDQKKAPLRLQ |
Gene Sequence | GIEALSVSSGSWSSATVWILTGLGLGLSRPFLPGATVLRDRPLGSAFELSYDQKKAPLRLQ |
Gene ID - Mouse | ENSMUSG00000006403 |
Gene ID - Rat | ENSRNOG00000025069 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti TP53AIP1 pAb (ATL-HPA048797) | |
Datasheet | Anti TP53AIP1 pAb (ATL-HPA048797) Datasheet (External Link) |
Vendor Page | Anti TP53AIP1 pAb (ATL-HPA048797) at Atlas Antibodies |
Documents & Links for Anti TP53AIP1 pAb (ATL-HPA048797) | |
Datasheet | Anti TP53AIP1 pAb (ATL-HPA048797) Datasheet (External Link) |
Vendor Page | Anti TP53AIP1 pAb (ATL-HPA048797) |