Anti TP53 pAb (ATL-HPA063532)

Atlas Antibodies

Catalog No.:
ATL-HPA063532-25
Shipping:
Calculated at Checkout
$351.00
Adding to cart… The item has been added
Protein Description: tumor protein p53
Gene Name: TP53
Alternative Gene Name: LFS1, p53
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000059552: 58%, ENSRNOG00000010756: 48%
Entrez Gene ID: 7157
Uniprot ID: P04637
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGPDEAP
Gene Sequence QSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGPDEAP
Gene ID - Mouse ENSMUSG00000059552
Gene ID - Rat ENSRNOG00000010756
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TP53 pAb (ATL-HPA063532)
Datasheet Anti TP53 pAb (ATL-HPA063532) Datasheet (External Link)
Vendor Page Anti TP53 pAb (ATL-HPA063532) at Atlas Antibodies

Documents & Links for Anti TP53 pAb (ATL-HPA063532)
Datasheet Anti TP53 pAb (ATL-HPA063532) Datasheet (External Link)
Vendor Page Anti TP53 pAb (ATL-HPA063532)