Anti TP53 pAb (ATL-HPA063532)
Atlas Antibodies
- Catalog No.:
- ATL-HPA063532-25
- Shipping:
- Calculated at Checkout
$351.00
Gene Name: TP53
Alternative Gene Name: LFS1, p53
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000059552: 58%, ENSRNOG00000010756: 48%
Entrez Gene ID: 7157
Uniprot ID: P04637
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | QSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGPDEAP |
| Gene Sequence | QSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGPDEAP |
| Gene ID - Mouse | ENSMUSG00000059552 |
| Gene ID - Rat | ENSRNOG00000010756 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti TP53 pAb (ATL-HPA063532) | |
| Datasheet | Anti TP53 pAb (ATL-HPA063532) Datasheet (External Link) |
| Vendor Page | Anti TP53 pAb (ATL-HPA063532) at Atlas Antibodies |
| Documents & Links for Anti TP53 pAb (ATL-HPA063532) | |
| Datasheet | Anti TP53 pAb (ATL-HPA063532) Datasheet (External Link) |
| Vendor Page | Anti TP53 pAb (ATL-HPA063532) |