Anti TOX3 pAb (ATL-HPA040376 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA040376-25

Protein Description: TOX high mobility group box family member 3
Gene Name: TOX3
Alternative Gene Name: CAGF9, TNRC9
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043668: 93%, ENSRNOG00000028649: 95%
Entrez Gene ID: 27324
Uniprot ID: O15405
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC, ChIP-Exo-Seq
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SQGSEFTPQFPPQSLDLPSITISRNLVEQDGVLHSSGLHMDQSHTQVSQYRQDPSLIMRSIVHMTDAARSGVMP
• Gene Sequence: SQGSEFTPQFPPQSLDLPSITISRNLVEQDGVLHSSGLHMDQSHTQVSQYRQDPSLIMRSIVHMTDAARSGVMP
• Gene ID - Mouse: ENSMUSG00000043668
• Gene ID - Rat: ENSRNOG00000028649
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.