Anti TOX2 pAb (ATL-HPA058396)
Atlas Antibodies
- Catalog No.:
 - ATL-HPA058396-25
 
- Shipping:
 - Calculated at Checkout
 
        
            
        
        
        $303.00
    
         
                            Gene Name: TOX2
Alternative Gene Name: C20orf100, dJ1108D11.2, GCX-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000074607: 95%, ENSRNOG00000008146: 95%
Entrez Gene ID: 84969
Uniprot ID: Q96NM4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC | 
| Reactivity | Human | 
| Clonality | Polyclonal | 
| Host | Rabbit | 
| Immunogen | HEASYHSLCHGLTPNGLLPAYSYQAMDLPAIMVSNMLAQDSHLLSGQLPTIQEMVHSEVAAYDSGR | 
| Gene Sequence | HEASYHSLCHGLTPNGLLPAYSYQAMDLPAIMVSNMLAQDSHLLSGQLPTIQEMVHSEVAAYDSGR | 
| Gene ID - Mouse | ENSMUSG00000074607 | 
| Gene ID - Rat | ENSRNOG00000008146 | 
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. | 
| Documents & Links for Anti TOX2 pAb (ATL-HPA058396) | |
| Datasheet | Anti TOX2 pAb (ATL-HPA058396) Datasheet (External Link) | 
| Vendor Page | Anti TOX2 pAb (ATL-HPA058396) at Atlas Antibodies | 
| Documents & Links for Anti TOX2 pAb (ATL-HPA058396) | |
| Datasheet | Anti TOX2 pAb (ATL-HPA058396) Datasheet (External Link) | 
| Vendor Page | Anti TOX2 pAb (ATL-HPA058396) |