Anti TOX2 pAb (ATL-HPA058396)

Atlas Antibodies

SKU: ATL-HPA058396-25

• 

Protein Description: TOX high mobility group box family member 2
Gene Name: TOX2
Alternative Gene Name: C20orf100, dJ1108D11.2, GCX-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000074607: 95%, ENSRNOG00000008146: 95%
Entrez Gene ID: 84969
Uniprot ID: Q96NM4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: HEASYHSLCHGLTPNGLLPAYSYQAMDLPAIMVSNMLAQDSHLLSGQLPTIQEMVHSEVAAYDSGR
• Gene Sequence: HEASYHSLCHGLTPNGLLPAYSYQAMDLPAIMVSNMLAQDSHLLSGQLPTIQEMVHSEVAAYDSGR
• Gene ID - Mouse: ENSMUSG00000074607
• Gene ID - Rat: ENSRNOG00000008146
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.