Anti TOX2 pAb (ATL-HPA049900 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA049900-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: TOX high mobility group box family member 2
Gene Name: TOX2
Alternative Gene Name: C20orf100, dJ1108D11.2, GCX-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000074607: 88%, ENSRNOG00000008146: 80%
Entrez Gene ID: 84969
Uniprot ID: Q96NM4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen IAGVFPQKFDGDSAYVGMSDGNPELLSTSQTYNGQSENNEDYEIPPITPPN
Gene Sequence IAGVFPQKFDGDSAYVGMSDGNPELLSTSQTYNGQSENNEDYEIPPITPPN
Gene ID - Mouse ENSMUSG00000074607
Gene ID - Rat ENSRNOG00000008146
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TOX2 pAb (ATL-HPA049900 w/enhanced validation)
Datasheet Anti TOX2 pAb (ATL-HPA049900 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti TOX2 pAb (ATL-HPA049900 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti TOX2 pAb (ATL-HPA049900 w/enhanced validation)
Datasheet Anti TOX2 pAb (ATL-HPA049900 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti TOX2 pAb (ATL-HPA049900 w/enhanced validation)