Anti TOX pAb (ATL-HPA018322 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA018322-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: TOX
Alternative Gene Name: KIAA0808, TOX1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041272: 98%, ENSRNOG00000010777: 98%
Entrez Gene ID: 9760
Uniprot ID: O94900
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PDAPCLGPSPCLDPYYCNKFDGENMYMSMTEPSQDYVPASQSYPGPSLESEDFNIPPITPPSLPDHSLVHLNEVESGYHSLCHPMNHNGLLPFHPQN |
| Gene Sequence | PDAPCLGPSPCLDPYYCNKFDGENMYMSMTEPSQDYVPASQSYPGPSLESEDFNIPPITPPSLPDHSLVHLNEVESGYHSLCHPMNHNGLLPFHPQN |
| Gene ID - Mouse | ENSMUSG00000041272 |
| Gene ID - Rat | ENSRNOG00000010777 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti TOX pAb (ATL-HPA018322 w/enhanced validation) | |
| Datasheet | Anti TOX pAb (ATL-HPA018322 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti TOX pAb (ATL-HPA018322 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti TOX pAb (ATL-HPA018322 w/enhanced validation) | |
| Datasheet | Anti TOX pAb (ATL-HPA018322 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti TOX pAb (ATL-HPA018322 w/enhanced validation) |
| Citations for Anti TOX pAb (ATL-HPA018322 w/enhanced validation) – 5 Found |
| Schrader, Anne M R; Jansen, Patty M; Willemze, Rein. TOX expression in cutaneous B-cell lymphomas. Archives Of Dermatological Research. 2016;308(6):423-7. PubMed |
| McGirt, L Y; Degesys, C A; Johnson, V E; Zic, J A; Zwerner, J P; Eischen, C M. TOX expression and role in CTCL. Journal Of The European Academy Of Dermatology And Venereology : Jeadv. 2016;30(9):1497-502. PubMed |
| McGirt, Laura Y; Adams, Clare M; Baerenwald, Devin A; Zwerner, Jeffrey P; Zic, John A; Eischen, Christine M. miR-223 regulates cell growth and targets proto-oncogenes in mycosis fungoides/cutaneous T-cell lymphoma. The Journal Of Investigative Dermatology. 2014;134(4):1101-1107. PubMed |
| Xu, Jingkai; Huang, He; Wang, Shangshang; Chen, Yanzhen; Yin, Xueli; Zhang, Xuejun; Zhang, Yaohua. Molecular profiling of TOX-deficient neoplastic cells in cutaneous T cell lymphoma. Archives Of Dermatological Research. 2020;312(7):513-525. PubMed |
| Boki, Hikari; Miyagaki, Tomomitsu; Shono, Yuki; Kamijo, Hiroaki; Oka, Tomonori; Suga, Hiraku; Asano, Yoshihide; Sugaya, Makoto; Sato, Shinichi. Increased Expression of Delta-like Ligand 4 in Mycosis Fungoides. Acta Dermato-Venereologica. 2020;100(4):adv00059. PubMed |