Anti TOR2A pAb (ATL-HPA071229)
Atlas Antibodies
- Catalog No.:
- ATL-HPA071229-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: TOR2A
Alternative Gene Name: FLJ14771, TORP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000009563: 90%, ENSRNOG00000022514: 90%
Entrez Gene ID: 27433
Uniprot ID: Q5JU69
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | AIFIFISNTGGEQINQVALEAWRSRRDREEILLQELEPVIS |
| Gene Sequence | AIFIFISNTGGEQINQVALEAWRSRRDREEILLQELEPVIS |
| Gene ID - Mouse | ENSMUSG00000009563 |
| Gene ID - Rat | ENSRNOG00000022514 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti TOR2A pAb (ATL-HPA071229) | |
| Datasheet | Anti TOR2A pAb (ATL-HPA071229) Datasheet (External Link) |
| Vendor Page | Anti TOR2A pAb (ATL-HPA071229) at Atlas Antibodies |
| Documents & Links for Anti TOR2A pAb (ATL-HPA071229) | |
| Datasheet | Anti TOR2A pAb (ATL-HPA071229) Datasheet (External Link) |
| Vendor Page | Anti TOR2A pAb (ATL-HPA071229) |