Anti TOR2A pAb (ATL-HPA071229)

Atlas Antibodies

Catalog No.: ATL-HPA071229-25

Protein Description: torsin family 2 member A
Gene Name: TOR2A
Alternative Gene Name: FLJ14771, TORP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000009563: 90%, ENSRNOG00000022514: 90%
Entrez Gene ID: 27433
Uniprot ID: Q5JU69
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AIFIFISNTGGEQINQVALEAWRSRRDREEILLQELEPVIS
• Gene Sequence: AIFIFISNTGGEQINQVALEAWRSRRDREEILLQELEPVIS
• Gene ID - Mouse: ENSMUSG00000009563
• Gene ID - Rat: ENSRNOG00000022514
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.