Anti TOR1AIP2 pAb (ATL-HPA058348)
Atlas Antibodies
- Catalog No.:
- ATL-HPA058348-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: TOR1AIP2
Alternative Gene Name: IFRG15, LULL1, NET9
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050565: 100%, ENSRNOG00000048267: 100%
Entrez Gene ID: 163590
Uniprot ID: Q9H496
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SDNSHCPDCGQQWFPSLELGHWLYQTELVENECYQVFLDRINRADYCPECYPDNPANRSLV |
| Gene Sequence | SDNSHCPDCGQQWFPSLELGHWLYQTELVENECYQVFLDRINRADYCPECYPDNPANRSLV |
| Gene ID - Mouse | ENSMUSG00000050565 |
| Gene ID - Rat | ENSRNOG00000048267 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti TOR1AIP2 pAb (ATL-HPA058348) | |
| Datasheet | Anti TOR1AIP2 pAb (ATL-HPA058348) Datasheet (External Link) |
| Vendor Page | Anti TOR1AIP2 pAb (ATL-HPA058348) at Atlas Antibodies |
| Documents & Links for Anti TOR1AIP2 pAb (ATL-HPA058348) | |
| Datasheet | Anti TOR1AIP2 pAb (ATL-HPA058348) Datasheet (External Link) |
| Vendor Page | Anti TOR1AIP2 pAb (ATL-HPA058348) |