Anti TOR1AIP1 pAb (ATL-HPA070991)
Atlas Antibodies
- Catalog No.:
- ATL-HPA070991-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: TOR1AIP1
Alternative Gene Name: FLJ13142, LAP1B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026466: 84%, ENSRNOG00000003946: 85%
Entrez Gene ID: 26092
Uniprot ID: Q5JTV8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | TTAVQEFQNQMNQLKNKYQGQDEKLWKRSQTFLEKHLNSSHPRSQPAILLLTAARDAEEALRCLSEQIADAYSSFRSVRAI |
| Gene Sequence | TTAVQEFQNQMNQLKNKYQGQDEKLWKRSQTFLEKHLNSSHPRSQPAILLLTAARDAEEALRCLSEQIADAYSSFRSVRAI |
| Gene ID - Mouse | ENSMUSG00000026466 |
| Gene ID - Rat | ENSRNOG00000003946 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti TOR1AIP1 pAb (ATL-HPA070991) | |
| Datasheet | Anti TOR1AIP1 pAb (ATL-HPA070991) Datasheet (External Link) |
| Vendor Page | Anti TOR1AIP1 pAb (ATL-HPA070991) at Atlas Antibodies |
| Documents & Links for Anti TOR1AIP1 pAb (ATL-HPA070991) | |
| Datasheet | Anti TOR1AIP1 pAb (ATL-HPA070991) Datasheet (External Link) |
| Vendor Page | Anti TOR1AIP1 pAb (ATL-HPA070991) |