Anti TOR1AIP1 pAb (ATL-HPA070991)
Atlas Antibodies
- Catalog No.:
- ATL-HPA070991-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: TOR1AIP1
Alternative Gene Name: FLJ13142, LAP1B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026466: 84%, ENSRNOG00000003946: 85%
Entrez Gene ID: 26092
Uniprot ID: Q5JTV8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | TTAVQEFQNQMNQLKNKYQGQDEKLWKRSQTFLEKHLNSSHPRSQPAILLLTAARDAEEALRCLSEQIADAYSSFRSVRAI |
Gene Sequence | TTAVQEFQNQMNQLKNKYQGQDEKLWKRSQTFLEKHLNSSHPRSQPAILLLTAARDAEEALRCLSEQIADAYSSFRSVRAI |
Gene ID - Mouse | ENSMUSG00000026466 |
Gene ID - Rat | ENSRNOG00000003946 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti TOR1AIP1 pAb (ATL-HPA070991) | |
Datasheet | Anti TOR1AIP1 pAb (ATL-HPA070991) Datasheet (External Link) |
Vendor Page | Anti TOR1AIP1 pAb (ATL-HPA070991) at Atlas Antibodies |
Documents & Links for Anti TOR1AIP1 pAb (ATL-HPA070991) | |
Datasheet | Anti TOR1AIP1 pAb (ATL-HPA070991) Datasheet (External Link) |
Vendor Page | Anti TOR1AIP1 pAb (ATL-HPA070991) |