Anti TOR1AIP1 pAb (ATL-HPA070991)

Atlas Antibodies

Catalog No.:
ATL-HPA070991-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: torsin 1A interacting protein 1
Gene Name: TOR1AIP1
Alternative Gene Name: FLJ13142, LAP1B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026466: 84%, ENSRNOG00000003946: 85%
Entrez Gene ID: 26092
Uniprot ID: Q5JTV8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TTAVQEFQNQMNQLKNKYQGQDEKLWKRSQTFLEKHLNSSHPRSQPAILLLTAARDAEEALRCLSEQIADAYSSFRSVRAI
Gene Sequence TTAVQEFQNQMNQLKNKYQGQDEKLWKRSQTFLEKHLNSSHPRSQPAILLLTAARDAEEALRCLSEQIADAYSSFRSVRAI
Gene ID - Mouse ENSMUSG00000026466
Gene ID - Rat ENSRNOG00000003946
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TOR1AIP1 pAb (ATL-HPA070991)
Datasheet Anti TOR1AIP1 pAb (ATL-HPA070991) Datasheet (External Link)
Vendor Page Anti TOR1AIP1 pAb (ATL-HPA070991) at Atlas Antibodies

Documents & Links for Anti TOR1AIP1 pAb (ATL-HPA070991)
Datasheet Anti TOR1AIP1 pAb (ATL-HPA070991) Datasheet (External Link)
Vendor Page Anti TOR1AIP1 pAb (ATL-HPA070991)