Anti TOR1AIP1 pAb (ATL-HPA050546 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA050546-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: TOR1AIP1
Alternative Gene Name: FLJ13142, LAP1B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026466: 46%, ENSRNOG00000003946: 47%
Entrez Gene ID: 26092
Uniprot ID: Q5JTV8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | EATSVQQKVNFSEEGETEEDDQDSSHSSVTTVKARSRDSDESGDKTTRSSSQYIESFWQSSQSQNFTAHDKQRSVLSSGYQKTPQEWAPQTARIRTRMQ |
Gene Sequence | EATSVQQKVNFSEEGETEEDDQDSSHSSVTTVKARSRDSDESGDKTTRSSSQYIESFWQSSQSQNFTAHDKQRSVLSSGYQKTPQEWAPQTARIRTRMQ |
Gene ID - Mouse | ENSMUSG00000026466 |
Gene ID - Rat | ENSRNOG00000003946 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti TOR1AIP1 pAb (ATL-HPA050546 w/enhanced validation) | |
Datasheet | Anti TOR1AIP1 pAb (ATL-HPA050546 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti TOR1AIP1 pAb (ATL-HPA050546 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti TOR1AIP1 pAb (ATL-HPA050546 w/enhanced validation) | |
Datasheet | Anti TOR1AIP1 pAb (ATL-HPA050546 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti TOR1AIP1 pAb (ATL-HPA050546 w/enhanced validation) |
Citations for Anti TOR1AIP1 pAb (ATL-HPA050546 w/enhanced validation) – 3 Found |
Lessel, Ivana; Chen, Mei-Jan; Lüttgen, Sabine; Arndt, Florian; Fuchs, Sigrid; Meien, Stefanie; Thiele, Holger; Jones, Julie R; Shaw, Brandon R; Crossman, David K; Nürnberg, Peter; Korf, Bruce R; Kubisch, Christian; Lessel, Davor. Two novel cases further expand the phenotype of TOR1AIP1-associated nuclear envelopathies. Human Genetics. 2020;139(4):483-498. PubMed |
Pereira, Cátia D; Martins, Filipa; Santos, Mariana; Müeller, Thorsten; da Cruz E Silva, Odete A B; Rebelo, Sandra. Nuclear Accumulation of LAP1:TRF2 Complex during DNA Damage Response Uncovers a Novel Role for LAP1. Cells. 2020;9(8) PubMed |
Cossins, Judith; Webster, Richard; Maxwell, Susan; Rodríguez Cruz, Pedro M; Knight, Ravi; Llewelyn, John Gareth; Shin, Ji-Yeon; Palace, Jacqueline; Beeson, David. Congenital myasthenic syndrome due to a TOR1AIP1 mutation: a new disease pathway for impaired synaptic transmission. Brain Communications. 2(2):fcaa174. PubMed |