Anti TOR1A pAb (ATL-HPA051195)

Atlas Antibodies

Catalog No.:
ATL-HPA051195-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: torsin family 1, member A (torsin A)
Gene Name: TOR1A
Alternative Gene Name: DQ2, DYT1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026849: 88%, ENSRNOG00000006894: 92%
Entrez Gene ID: 1861
Uniprot ID: O14656
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QAVEPISLGLALAGVLTGYIYPRLYCLFAECCGQKRSLSREALQKDLDDNLFGQHLAKK
Gene Sequence QAVEPISLGLALAGVLTGYIYPRLYCLFAECCGQKRSLSREALQKDLDDNLFGQHLAKK
Gene ID - Mouse ENSMUSG00000026849
Gene ID - Rat ENSRNOG00000006894
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TOR1A pAb (ATL-HPA051195)
Datasheet Anti TOR1A pAb (ATL-HPA051195) Datasheet (External Link)
Vendor Page Anti TOR1A pAb (ATL-HPA051195) at Atlas Antibodies

Documents & Links for Anti TOR1A pAb (ATL-HPA051195)
Datasheet Anti TOR1A pAb (ATL-HPA051195) Datasheet (External Link)
Vendor Page Anti TOR1A pAb (ATL-HPA051195)