Anti TOPORS pAb (ATL-HPA060640)
Atlas Antibodies
- Catalog No.:
- ATL-HPA060640-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: TOPORS
Alternative Gene Name: LUN, RP31, TP53BPL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036822: 85%, ENSRNOG00000006485: 86%
Entrez Gene ID: 10210
Uniprot ID: Q9NS56
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | GGATCQIQGVQTNDDLNNDSDDSSDNCVIVGFVKPLAERTPELVELSSDSEDLGSYEKMETVKTQEQEQSYSSGDSDVSRCSSPHSVLGKDEQINKGHCDSSTRIKSKKEEKRSTSLSSPRNL |
| Gene Sequence | GGATCQIQGVQTNDDLNNDSDDSSDNCVIVGFVKPLAERTPELVELSSDSEDLGSYEKMETVKTQEQEQSYSSGDSDVSRCSSPHSVLGKDEQINKGHCDSSTRIKSKKEEKRSTSLSSPRNL |
| Gene ID - Mouse | ENSMUSG00000036822 |
| Gene ID - Rat | ENSRNOG00000006485 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti TOPORS pAb (ATL-HPA060640) | |
| Datasheet | Anti TOPORS pAb (ATL-HPA060640) Datasheet (External Link) |
| Vendor Page | Anti TOPORS pAb (ATL-HPA060640) at Atlas Antibodies |
| Documents & Links for Anti TOPORS pAb (ATL-HPA060640) | |
| Datasheet | Anti TOPORS pAb (ATL-HPA060640) Datasheet (External Link) |
| Vendor Page | Anti TOPORS pAb (ATL-HPA060640) |