Anti TOPORS pAb (ATL-HPA060640)

Atlas Antibodies

Catalog No.:
ATL-HPA060640-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: topoisomerase I binding, arginine/serine-rich, E3 ubiquitin protein ligase
Gene Name: TOPORS
Alternative Gene Name: LUN, RP31, TP53BPL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036822: 85%, ENSRNOG00000006485: 86%
Entrez Gene ID: 10210
Uniprot ID: Q9NS56
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GGATCQIQGVQTNDDLNNDSDDSSDNCVIVGFVKPLAERTPELVELSSDSEDLGSYEKMETVKTQEQEQSYSSGDSDVSRCSSPHSVLGKDEQINKGHCDSSTRIKSKKEEKRSTSLSSPRNL
Gene Sequence GGATCQIQGVQTNDDLNNDSDDSSDNCVIVGFVKPLAERTPELVELSSDSEDLGSYEKMETVKTQEQEQSYSSGDSDVSRCSSPHSVLGKDEQINKGHCDSSTRIKSKKEEKRSTSLSSPRNL
Gene ID - Mouse ENSMUSG00000036822
Gene ID - Rat ENSRNOG00000006485
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TOPORS pAb (ATL-HPA060640)
Datasheet Anti TOPORS pAb (ATL-HPA060640) Datasheet (External Link)
Vendor Page Anti TOPORS pAb (ATL-HPA060640) at Atlas Antibodies

Documents & Links for Anti TOPORS pAb (ATL-HPA060640)
Datasheet Anti TOPORS pAb (ATL-HPA060640) Datasheet (External Link)
Vendor Page Anti TOPORS pAb (ATL-HPA060640)