Anti TOPAZ1 pAb (ATL-HPA051034)
Atlas Antibodies
- Catalog No.:
- ATL-HPA051034-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: TOPAZ1
Alternative Gene Name: C3orf77, FLJ36157
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000094985: 55%, ENSRNOG00000025601: 57%
Entrez Gene ID: 375337
Uniprot ID: Q8N9V7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | KSDTNSIPQLLQTEENVMGVNKLLPEESDLYQSKTNGLLSCLQHEKNKYSIEESSVGRKPRKRMKLSEKADETVTEMNFSNEYNKSELMLQENQM |
| Gene Sequence | KSDTNSIPQLLQTEENVMGVNKLLPEESDLYQSKTNGLLSCLQHEKNKYSIEESSVGRKPRKRMKLSEKADETVTEMNFSNEYNKSELMLQENQM |
| Gene ID - Mouse | ENSMUSG00000094985 |
| Gene ID - Rat | ENSRNOG00000025601 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti TOPAZ1 pAb (ATL-HPA051034) | |
| Datasheet | Anti TOPAZ1 pAb (ATL-HPA051034) Datasheet (External Link) |
| Vendor Page | Anti TOPAZ1 pAb (ATL-HPA051034) at Atlas Antibodies |
| Documents & Links for Anti TOPAZ1 pAb (ATL-HPA051034) | |
| Datasheet | Anti TOPAZ1 pAb (ATL-HPA051034) Datasheet (External Link) |
| Vendor Page | Anti TOPAZ1 pAb (ATL-HPA051034) |