Anti TOP3B pAb (ATL-HPA072114)
Atlas Antibodies
- SKU:
- ATL-HPA072114-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: TOP3B
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022779: 97%, ENSRNOG00000001845: 96%
Entrez Gene ID: 8940
Uniprot ID: O95985
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | TIKLYKELRCPLDDFELVLWSSGSRGKSYPLCPYCYNHPPFRDMKKGMGCNECTHPSCQHSLSMLGIGQCVECESGVLVLDPTSGPKWKVACNKCNVV |
Gene Sequence | TIKLYKELRCPLDDFELVLWSSGSRGKSYPLCPYCYNHPPFRDMKKGMGCNECTHPSCQHSLSMLGIGQCVECESGVLVLDPTSGPKWKVACNKCNVV |
Gene ID - Mouse | ENSMUSG00000022779 |
Gene ID - Rat | ENSRNOG00000001845 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti TOP3B pAb (ATL-HPA072114) | |
Datasheet | Anti TOP3B pAb (ATL-HPA072114) Datasheet (External Link) |
Vendor Page | Anti TOP3B pAb (ATL-HPA072114) at Atlas Antibodies |
Documents & Links for Anti TOP3B pAb (ATL-HPA072114) | |
Datasheet | Anti TOP3B pAb (ATL-HPA072114) Datasheet (External Link) |
Vendor Page | Anti TOP3B pAb (ATL-HPA072114) |