Anti TOP3B pAb (ATL-HPA072114)

Atlas Antibodies

Catalog No.:
ATL-HPA072114-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: DNA topoisomerase III beta
Gene Name: TOP3B
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022779: 97%, ENSRNOG00000001845: 96%
Entrez Gene ID: 8940
Uniprot ID: O95985
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TIKLYKELRCPLDDFELVLWSSGSRGKSYPLCPYCYNHPPFRDMKKGMGCNECTHPSCQHSLSMLGIGQCVECESGVLVLDPTSGPKWKVACNKCNVV
Gene Sequence TIKLYKELRCPLDDFELVLWSSGSRGKSYPLCPYCYNHPPFRDMKKGMGCNECTHPSCQHSLSMLGIGQCVECESGVLVLDPTSGPKWKVACNKCNVV
Gene ID - Mouse ENSMUSG00000022779
Gene ID - Rat ENSRNOG00000001845
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TOP3B pAb (ATL-HPA072114)
Datasheet Anti TOP3B pAb (ATL-HPA072114) Datasheet (External Link)
Vendor Page Anti TOP3B pAb (ATL-HPA072114) at Atlas Antibodies

Documents & Links for Anti TOP3B pAb (ATL-HPA072114)
Datasheet Anti TOP3B pAb (ATL-HPA072114) Datasheet (External Link)
Vendor Page Anti TOP3B pAb (ATL-HPA072114)