Anti TOP1 pAb (ATL-HPA019039 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA019039-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: topoisomerase (DNA) I
Gene Name: TOP1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000070544: 92%, ENSRNOG00000047611: 93%
Entrez Gene ID: 7150
Uniprot ID: P11387
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen KVRASGDAKIKKEKENGFSSPPQIKDEPEDDGYFVPPKEDIKPLKRPRDEDDADYKPKK
Gene Sequence KVRASGDAKIKKEKENGFSSPPQIKDEPEDDGYFVPPKEDIKPLKRPRDEDDADYKPKK
Gene ID - Mouse ENSMUSG00000070544
Gene ID - Rat ENSRNOG00000047611
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TOP1 pAb (ATL-HPA019039 w/enhanced validation)
Datasheet Anti TOP1 pAb (ATL-HPA019039 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti TOP1 pAb (ATL-HPA019039 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti TOP1 pAb (ATL-HPA019039 w/enhanced validation)
Datasheet Anti TOP1 pAb (ATL-HPA019039 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti TOP1 pAb (ATL-HPA019039 w/enhanced validation)
Citations for Anti TOP1 pAb (ATL-HPA019039 w/enhanced validation) – 1 Found
Israel, Steffen; Ernst, Mathias; Psathaki, Olympia E; Drexler, Hannes C A; Casser, Ellen; Suzuki, Yutaka; Makalowski, Wojciech; Boiani, Michele; Fuellen, Georg; Taher, Leila. An integrated genome-wide multi-omics analysis of gene expression dynamics in the preimplantation mouse embryo. Scientific Reports. 2019;9(1):13356.  PubMed