Anti TOP1 pAb (ATL-HPA019039 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA019039-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: TOP1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000070544: 92%, ENSRNOG00000047611: 93%
Entrez Gene ID: 7150
Uniprot ID: P11387
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | KVRASGDAKIKKEKENGFSSPPQIKDEPEDDGYFVPPKEDIKPLKRPRDEDDADYKPKK |
| Gene Sequence | KVRASGDAKIKKEKENGFSSPPQIKDEPEDDGYFVPPKEDIKPLKRPRDEDDADYKPKK |
| Gene ID - Mouse | ENSMUSG00000070544 |
| Gene ID - Rat | ENSRNOG00000047611 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti TOP1 pAb (ATL-HPA019039 w/enhanced validation) | |
| Datasheet | Anti TOP1 pAb (ATL-HPA019039 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti TOP1 pAb (ATL-HPA019039 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti TOP1 pAb (ATL-HPA019039 w/enhanced validation) | |
| Datasheet | Anti TOP1 pAb (ATL-HPA019039 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti TOP1 pAb (ATL-HPA019039 w/enhanced validation) |
| Citations for Anti TOP1 pAb (ATL-HPA019039 w/enhanced validation) – 1 Found |
| Israel, Steffen; Ernst, Mathias; Psathaki, Olympia E; Drexler, Hannes C A; Casser, Ellen; Suzuki, Yutaka; Makalowski, Wojciech; Boiani, Michele; Fuellen, Georg; Taher, Leila. An integrated genome-wide multi-omics analysis of gene expression dynamics in the preimplantation mouse embryo. Scientific Reports. 2019;9(1):13356. PubMed |