Anti TONSL pAb (ATL-HPA046494)
Atlas Antibodies
- Catalog No.:
- ATL-HPA046494-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: TONSL
Alternative Gene Name: IKBR, NFKBIL2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000059323: 84%, ENSRNOG00000014703: 88%
Entrez Gene ID: 4796
Uniprot ID: Q96HA7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | IRVRVQVQDHLFLIPVPHSSDTHSVAWLAEQAAQRYYQTCGLLPRLTLRKEGALLAPQDLIPDVLQSNDEVLAEVTSWDLPPLTDRYRRACQSLGQGEHQQVLQAVELQGLGLSFSACSLALDQAQLTPLLRALKLHT |
Gene Sequence | IRVRVQVQDHLFLIPVPHSSDTHSVAWLAEQAAQRYYQTCGLLPRLTLRKEGALLAPQDLIPDVLQSNDEVLAEVTSWDLPPLTDRYRRACQSLGQGEHQQVLQAVELQGLGLSFSACSLALDQAQLTPLLRALKLHT |
Gene ID - Mouse | ENSMUSG00000059323 |
Gene ID - Rat | ENSRNOG00000014703 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti TONSL pAb (ATL-HPA046494) | |
Datasheet | Anti TONSL pAb (ATL-HPA046494) Datasheet (External Link) |
Vendor Page | Anti TONSL pAb (ATL-HPA046494) at Atlas Antibodies |
Documents & Links for Anti TONSL pAb (ATL-HPA046494) | |
Datasheet | Anti TONSL pAb (ATL-HPA046494) Datasheet (External Link) |
Vendor Page | Anti TONSL pAb (ATL-HPA046494) |
Citations for Anti TONSL pAb (ATL-HPA046494) – 1 Found |
Hammond, Colin M; Bao, Hongyu; Hendriks, Ivo A; Carraro, Massimo; García-Nieto, Alberto; Liu, Yanhong; Reverón-Gómez, Nazaret; Spanos, Christos; Chen, Liu; Rappsilber, Juri; Nielsen, Michael L; Patel, Dinshaw J; Huang, Hongda; Groth, Anja. DNAJC9 integrates heat shock molecular chaperones into the histone chaperone network. Molecular Cell. 2021;81(12):2533-2548.e9. PubMed |