Anti TOMM40L pAb (ATL-HPA051304)
Atlas Antibodies
- Catalog No.:
- ATL-HPA051304-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: TOMM40L
Alternative Gene Name: FLJ12770, TOMM40B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005674: 96%, ENSRNOG00000003398: 96%
Entrez Gene ID: 84134
Uniprot ID: Q969M1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | VVNKVLSSHFQVAHTIHMSALGLPGYHLHAAYAGDWQLSPTEVFPTVVGDM |
Gene Sequence | VVNKVLSSHFQVAHTIHMSALGLPGYHLHAAYAGDWQLSPTEVFPTVVGDM |
Gene ID - Mouse | ENSMUSG00000005674 |
Gene ID - Rat | ENSRNOG00000003398 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti TOMM40L pAb (ATL-HPA051304) | |
Datasheet | Anti TOMM40L pAb (ATL-HPA051304) Datasheet (External Link) |
Vendor Page | Anti TOMM40L pAb (ATL-HPA051304) at Atlas Antibodies |
Documents & Links for Anti TOMM40L pAb (ATL-HPA051304) | |
Datasheet | Anti TOMM40L pAb (ATL-HPA051304) Datasheet (External Link) |
Vendor Page | Anti TOMM40L pAb (ATL-HPA051304) |