Anti TOMM34 pAb (ATL-HPA018845 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA018845-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: translocase of outer mitochondrial membrane 34
Gene Name: TOMM34
Alternative Gene Name: HTOM34P, TOM34
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018322: 89%, ENSRNOG00000029799: 88%
Entrez Gene ID: 10953
Uniprot ID: Q15785
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LCYLVLKQYTEAVKDCTEALKLDGKNVKAFYRRAQAHKALKDYKSSFADISNLLQIEPRNGPAQKLRQEVKQNL
Gene Sequence LCYLVLKQYTEAVKDCTEALKLDGKNVKAFYRRAQAHKALKDYKSSFADISNLLQIEPRNGPAQKLRQEVKQNL
Gene ID - Mouse ENSMUSG00000018322
Gene ID - Rat ENSRNOG00000029799
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TOMM34 pAb (ATL-HPA018845 w/enhanced validation)
Datasheet Anti TOMM34 pAb (ATL-HPA018845 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti TOMM34 pAb (ATL-HPA018845 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti TOMM34 pAb (ATL-HPA018845 w/enhanced validation)
Datasheet Anti TOMM34 pAb (ATL-HPA018845 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti TOMM34 pAb (ATL-HPA018845 w/enhanced validation)