Anti TOM1L1 pAb (ATL-HPA022916)
Atlas Antibodies
- Catalog No.:
- ATL-HPA022916-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: TOM1L1
Alternative Gene Name: SRCASM
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020541: 84%, ENSRNOG00000002474: 81%
Entrez Gene ID: 10040
Uniprot ID: O75674
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | WSQGFPGGVDVSEVKEVYLDLVKKGVQFPPSEAEAETARQETAQISSNPPTSVPTAPALSSVIAPKNSTVTLVPEQIGKLHSELDMVKMNVRVMS |
| Gene Sequence | WSQGFPGGVDVSEVKEVYLDLVKKGVQFPPSEAEAETARQETAQISSNPPTSVPTAPALSSVIAPKNSTVTLVPEQIGKLHSELDMVKMNVRVMS |
| Gene ID - Mouse | ENSMUSG00000020541 |
| Gene ID - Rat | ENSRNOG00000002474 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti TOM1L1 pAb (ATL-HPA022916) | |
| Datasheet | Anti TOM1L1 pAb (ATL-HPA022916) Datasheet (External Link) |
| Vendor Page | Anti TOM1L1 pAb (ATL-HPA022916) at Atlas Antibodies |
| Documents & Links for Anti TOM1L1 pAb (ATL-HPA022916) | |
| Datasheet | Anti TOM1L1 pAb (ATL-HPA022916) Datasheet (External Link) |
| Vendor Page | Anti TOM1L1 pAb (ATL-HPA022916) |