Anti TOGARAM2 pAb (ATL-HPA037561)

Atlas Antibodies

Catalog No.:
ATL-HPA037561-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: TOG array regulator of axonemal microtubules 2
Gene Name: TOGARAM2
Alternative Gene Name: Crescerin-2, FAM179A, FLJ43249, LOC165186
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045761: 74%, ENSRNOG00000026344: 62%
Entrez Gene ID: 165186
Uniprot ID: Q6ZUX3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GLSCNGPRLVGLRSTLQGRGEMVEQLRELTRLLEAKDFRSRMEGVGQLLELCKAKTELVTAHLVQVFDAFTPRLQDSNKKVNQWALESFAKMI
Gene Sequence GLSCNGPRLVGLRSTLQGRGEMVEQLRELTRLLEAKDFRSRMEGVGQLLELCKAKTELVTAHLVQVFDAFTPRLQDSNKKVNQWALESFAKMI
Gene ID - Mouse ENSMUSG00000045761
Gene ID - Rat ENSRNOG00000026344
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TOGARAM2 pAb (ATL-HPA037561)
Datasheet Anti TOGARAM2 pAb (ATL-HPA037561) Datasheet (External Link)
Vendor Page Anti TOGARAM2 pAb (ATL-HPA037561) at Atlas Antibodies

Documents & Links for Anti TOGARAM2 pAb (ATL-HPA037561)
Datasheet Anti TOGARAM2 pAb (ATL-HPA037561) Datasheet (External Link)
Vendor Page Anti TOGARAM2 pAb (ATL-HPA037561)