Anti TOGARAM2 pAb (ATL-HPA037561)
Atlas Antibodies
- Catalog No.:
- ATL-HPA037561-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: TOGARAM2
Alternative Gene Name: Crescerin-2, FAM179A, FLJ43249, LOC165186
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045761: 74%, ENSRNOG00000026344: 62%
Entrez Gene ID: 165186
Uniprot ID: Q6ZUX3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | GLSCNGPRLVGLRSTLQGRGEMVEQLRELTRLLEAKDFRSRMEGVGQLLELCKAKTELVTAHLVQVFDAFTPRLQDSNKKVNQWALESFAKMI |
| Gene Sequence | GLSCNGPRLVGLRSTLQGRGEMVEQLRELTRLLEAKDFRSRMEGVGQLLELCKAKTELVTAHLVQVFDAFTPRLQDSNKKVNQWALESFAKMI |
| Gene ID - Mouse | ENSMUSG00000045761 |
| Gene ID - Rat | ENSRNOG00000026344 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti TOGARAM2 pAb (ATL-HPA037561) | |
| Datasheet | Anti TOGARAM2 pAb (ATL-HPA037561) Datasheet (External Link) |
| Vendor Page | Anti TOGARAM2 pAb (ATL-HPA037561) at Atlas Antibodies |
| Documents & Links for Anti TOGARAM2 pAb (ATL-HPA037561) | |
| Datasheet | Anti TOGARAM2 pAb (ATL-HPA037561) Datasheet (External Link) |
| Vendor Page | Anti TOGARAM2 pAb (ATL-HPA037561) |