Anti TOGARAM1 pAb (ATL-HPA053559)
Atlas Antibodies
- Catalog No.:
- ATL-HPA053559-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: TOGARAM1
Alternative Gene Name: crescerin, Crescerin-1, FAM179B, KIAA0423
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035614: 97%, ENSRNOG00000004415: 96%
Entrez Gene ID: 23116
Uniprot ID: Q9Y4F4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LLLEHLKHKHSRVREEVVNICICSLLTYPSEDFDLPKLSFDLAPALVDSKRRVRQAALEAFAVLASSMGSGKTSILFKAVDTVELQDNGDGVMNAVQ |
| Gene Sequence | LLLEHLKHKHSRVREEVVNICICSLLTYPSEDFDLPKLSFDLAPALVDSKRRVRQAALEAFAVLASSMGSGKTSILFKAVDTVELQDNGDGVMNAVQ |
| Gene ID - Mouse | ENSMUSG00000035614 |
| Gene ID - Rat | ENSRNOG00000004415 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti TOGARAM1 pAb (ATL-HPA053559) | |
| Datasheet | Anti TOGARAM1 pAb (ATL-HPA053559) Datasheet (External Link) |
| Vendor Page | Anti TOGARAM1 pAb (ATL-HPA053559) at Atlas Antibodies |
| Documents & Links for Anti TOGARAM1 pAb (ATL-HPA053559) | |
| Datasheet | Anti TOGARAM1 pAb (ATL-HPA053559) Datasheet (External Link) |
| Vendor Page | Anti TOGARAM1 pAb (ATL-HPA053559) |