Anti TOGARAM1 pAb (ATL-HPA053559)

Atlas Antibodies

SKU: ATL-HPA053559-25

• 

Protein Description: TOG array regulator of axonemal microtubules 1
Gene Name: TOGARAM1
Alternative Gene Name: crescerin, Crescerin-1, FAM179B, KIAA0423
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035614: 97%, ENSRNOG00000004415: 96%
Entrez Gene ID: 23116
Uniprot ID: Q9Y4F4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LLLEHLKHKHSRVREEVVNICICSLLTYPSEDFDLPKLSFDLAPALVDSKRRVRQAALEAFAVLASSMGSGKTSILFKAVDTVELQDNGDGVMNAVQ
• Gene Sequence: LLLEHLKHKHSRVREEVVNICICSLLTYPSEDFDLPKLSFDLAPALVDSKRRVRQAALEAFAVLASSMGSGKTSILFKAVDTVELQDNGDGVMNAVQ
• Gene ID - Mouse: ENSMUSG00000035614
• Gene ID - Rat: ENSRNOG00000004415
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.