Anti TOE1 pAb (ATL-HPA069119 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA069119-100
Shipping:
Calculated at Checkout
$638.00
Adding to cart… The item has been added
Protein Description: target of EGR1, member 1 (nuclear)
Gene Name: TOE1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028688: 88%, ENSRNOG00000017561: 88%
Entrez Gene ID: 114034
Uniprot ID: Q96GM8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LHRAGFDAFMTGYVMAYVEVSQGPQPCSSGPWLPECHNKVYLSGKAVPLTVAKSQFSRSSKAHNQKMKLTWGS
Gene Sequence LHRAGFDAFMTGYVMAYVEVSQGPQPCSSGPWLPECHNKVYLSGKAVPLTVAKSQFSRSSKAHNQKMKLTWGS
Gene ID - Mouse ENSMUSG00000028688
Gene ID - Rat ENSRNOG00000017561
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TOE1 pAb (ATL-HPA069119 w/enhanced validation)
Datasheet Anti TOE1 pAb (ATL-HPA069119 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti TOE1 pAb (ATL-HPA069119 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti TOE1 pAb (ATL-HPA069119 w/enhanced validation)
Datasheet Anti TOE1 pAb (ATL-HPA069119 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti TOE1 pAb (ATL-HPA069119 w/enhanced validation)