Anti TOB2 pAb (ATL-HPA054112)
Atlas Antibodies
- Catalog No.:
- ATL-HPA054112-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: TOB2
Alternative Gene Name: bK223H9, TOB4, TOBL, TROB2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048546: 82%, ENSRNOG00000050500: 82%
Entrez Gene ID: 10766
Uniprot ID: Q14106
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | GVASSGAGGQQPPQQPRMARSPTNSLLKHKSLS |
| Gene Sequence | GVASSGAGGQQPPQQPRMARSPTNSLLKHKSLS |
| Gene ID - Mouse | ENSMUSG00000048546 |
| Gene ID - Rat | ENSRNOG00000050500 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti TOB2 pAb (ATL-HPA054112) | |
| Datasheet | Anti TOB2 pAb (ATL-HPA054112) Datasheet (External Link) |
| Vendor Page | Anti TOB2 pAb (ATL-HPA054112) at Atlas Antibodies |
| Documents & Links for Anti TOB2 pAb (ATL-HPA054112) | |
| Datasheet | Anti TOB2 pAb (ATL-HPA054112) Datasheet (External Link) |
| Vendor Page | Anti TOB2 pAb (ATL-HPA054112) |