Anti TNS3 pAb (ATL-HPA056015)

Atlas Antibodies

Catalog No.:
ATL-HPA056015-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: tensin 3
Gene Name: TNS3
Alternative Gene Name: FLJ13732, H_NH0549I23.2, TEM6, TENS1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020422: 69%, ENSRNOG00000025695: 73%
Entrez Gene ID: 64759
Uniprot ID: Q68CZ2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VGSGPHPPDTQQPSPSKAFKPRFPGDQVVNGAGPELSTGPSPGSPTLDIDQSIEQLNRLILELDPTFEPIPTHMNALGSQANGSV
Gene Sequence VGSGPHPPDTQQPSPSKAFKPRFPGDQVVNGAGPELSTGPSPGSPTLDIDQSIEQLNRLILELDPTFEPIPTHMNALGSQANGSV
Gene ID - Mouse ENSMUSG00000020422
Gene ID - Rat ENSRNOG00000025695
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TNS3 pAb (ATL-HPA056015)
Datasheet Anti TNS3 pAb (ATL-HPA056015) Datasheet (External Link)
Vendor Page Anti TNS3 pAb (ATL-HPA056015) at Atlas Antibodies

Documents & Links for Anti TNS3 pAb (ATL-HPA056015)
Datasheet Anti TNS3 pAb (ATL-HPA056015) Datasheet (External Link)
Vendor Page Anti TNS3 pAb (ATL-HPA056015)